Protein Info for HGI48_RS13590 in Dickeya dianthicola 67-19

Annotation: chemotaxis protein CheA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 PF01627: Hpt" amino acids 4 to 94 (91 residues), 66.6 bits, see alignment E=4.8e-22 PF09078: CheY-binding" amino acids 161 to 223 (63 residues), 84.6 bits, see alignment E=9.9e-28 PF02895: H-kinase_dim" amino acids 283 to 345 (63 residues), 71.2 bits, see alignment E=2e-23 PF02518: HATPase_c" amino acids 393 to 529 (137 residues), 62.1 bits, see alignment E=1.6e-20 PF01584: CheW" amino acids 535 to 661 (127 residues), 103 bits, see alignment E=2.7e-33

Best Hits

Swiss-Prot: 75% identical to CHEA_SALTY: Chemotaxis protein CheA (cheA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03407, two-component system, chemotaxis family, sensor kinase CheA [EC: 2.7.13.3] (inferred from 94% identity to ddd:Dda3937_02781)

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RK59 at UniProt or InterPro

Protein Sequence (675 amino acids)

>HGI48_RS13590 chemotaxis protein CheA (Dickeya dianthicola 67-19)
MSAFYQTFFDEADELLADMEQHLLQLDPLAPDTEQMNAIFRAAHSIKGGAGTFGFRVLQE
TTHILENLLDGARRGEMRLSTDIINLFLETKDIMQDQLDAYKTSQEPNAESFEYICQALR
QLALESKENDAAGAASAKVDAGQPVSSSAAPAPAGGHSGLRIALTGLKESDIPQLLEELG
NLGTVKETVQTSNSVELTLETSASEDDISAVLCFVLEPDQINFKSAAEAVPADAVPPVVA
QAEQAEPAPAAPVQPVAPVAAAPAAKPAGGNDAAKGRQKTGDTSIRVAVEKVDQLINLVG
ELVITQSMLAQRSSALDPVAHGDLLNSMGQLERNARDLQESVMSIRMMPMEYVFSRFPRL
VRDLAAKLGKEVELTQLGSSTELDKSLIERIIDPLTHLVRNSLDHGIESPETRIESGKSA
VGNLTLSAEHQGGNICIEVIDDGAGLNRERILAKALSQGMAVNESMSDEDVGMLIFAPGF
STAEKVTDVSGRGVGMDVVKRNIQEMGGHVEIHFVKGKGTTIRILLPLTLAILDGMSVKV
NNEVFILPLNAVMESLQPQAEDLYPLAGGERVLQVRGEYLPLIELYQVFDVAGAKTDATQ
GIVVILQSAGRRYALLVDQLIGQHQVVVKNLESNYRKVPGVSAATILGDGSVALIVDVSA
LQALYREKRVVETAA