Protein Info for HGI48_RS12575 in Dickeya dianthicola 67-19

Annotation: stress response translation initiation inhibitor YciH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR01158: putative translation initiation factor SUI1" amino acids 8 to 108 (101 residues), 133.1 bits, see alignment E=1.8e-43 PF01253: SUI1" amino acids 31 to 102 (72 residues), 76.1 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 88% identical to YCIH_ECOLI: Uncharacterized protein YciH (yciH) from Escherichia coli (strain K12)

KEGG orthology group: K03113, translation initiation factor 1 (inferred from 93% identity to ddc:Dd586_1688)

Predicted SEED Role

"Translation initiation factor SUI1-related protein" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9REJ5 at UniProt or InterPro

Protein Sequence (108 amino acids)

>HGI48_RS12575 stress response translation initiation inhibitor YciH (Dickeya dianthicola 67-19)
MRDDNSRLVYSTETGRIDEPAAKAARPKGDGIVRIQRQTSGRKGKGVCLITGVDLDDAAL
ETLAAELKKKCGCGGAVKDGAIEIQGDKRDQLKQLLEAKGMKVKLAGG