Protein Info for HGI48_RS11335 in Dickeya dianthicola 67-19

Annotation: manganese efflux pump MntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 57 to 61 (5 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details PF02659: Mntp" amino acids 31 to 182 (152 residues), 184.7 bits, see alignment E=4.6e-59

Best Hits

Swiss-Prot: 83% identical to MNTP_PECCP: Putative manganese efflux pump MntP (mntP) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: None (inferred from 93% identity to ddc:Dd586_1970)

MetaCyc: 68% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RDX5 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HGI48_RS11335 manganese efflux pump MntP (Dickeya dianthicola 67-19)
MNLSATLILAFGMSMDAFAASIGKGAALHNPRFREAIRTGLIFGLIEALTPLIGWALGFY
ASRFIIAWDHWVAFSLLLILGGRMIMEGLKGEDSCNCEKISKHSLFILVCTAVATSLDAM
AIGVGLAFLQVNIFHTAMVIGCATMIMVTLGMMIGRYVGPIIGKRAEILGGIVLIGIGCN
ILYEHLFDFA