Protein Info for HGI48_RS08095 in Dickeya dianthicola 67-19

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01209: Ubie_methyltran" amino acids 19 to 160 (142 residues), 52.5 bits, see alignment E=2.1e-17 PF13489: Methyltransf_23" amino acids 44 to 158 (115 residues), 40.1 bits, see alignment E=1.4e-13 PF05175: MTS" amino acids 49 to 130 (82 residues), 29.3 bits, see alignment E=2.9e-10 PF06325: PrmA" amino acids 58 to 133 (76 residues), 22.6 bits, see alignment E=3e-08 PF13847: Methyltransf_31" amino acids 59 to 171 (113 residues), 70.2 bits, see alignment E=7.5e-23 PF09445: Methyltransf_15" amino acids 62 to 117 (56 residues), 27.1 bits, see alignment E=1.3e-09 PF13649: Methyltransf_25" amino acids 63 to 155 (93 residues), 81.3 bits, see alignment E=3.2e-26 PF08242: Methyltransf_12" amino acids 64 to 157 (94 residues), 50.8 bits, see alignment E=1.1e-16 PF08241: Methyltransf_11" amino acids 64 to 158 (95 residues), 87.2 bits, see alignment E=4.4e-28

Best Hits

KEGG orthology group: None (inferred from 89% identity to ddd:Dda3937_00763)

Predicted SEED Role

"SmtA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJC8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>HGI48_RS08095 class I SAM-dependent methyltransferase (Dickeya dianthicola 67-19)
MLTDDILTDDIASDGLLNQVKHYWSKRAQGYNAVNVAELTGDKRRLWQNLILQHAPKKPR
LTILDVGAGPGFFAVTLAMAGHRVTAVDATPAMLAQAKNNADVYGVDINFVAADVHTLPF
PDNHFDVLVTRNVTWNLKQPLAAYQEWRRVLAPGGRLINFDANWYAHLFNAEARDGYLRD
RQNARRLKMNDHYANTDTVAMENIARALPLSREIRPEWDRHTLLGCGFNQVFIDENIADN
LWDDEEKINYASTPMFMVVAEK