Protein Info for HGI48_RS08065 in Dickeya dianthicola 67-19
Annotation: iron-sulfur cluster-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to YKGF_ECOLI: Uncharacterized electron transport protein YkgF (ykgF) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00778)MetaCyc: 58% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]
Predicted SEED Role
"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization
MetaCyc Pathways
- hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
- superpathway of glucose and xylose degradation (16/17 steps found)
- homolactic fermentation (12/12 steps found)
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- Bifidobacterium shunt (13/15 steps found)
- heterolactic fermentation (15/18 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
- pyruvate fermentation to acetate and lactate II (4/4 steps found)
- pyruvate fermentation to (S)-lactate (1/1 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A7L9RC80 at UniProt or InterPro
Protein Sequence (475 amino acids)
>HGI48_RS08065 iron-sulfur cluster-binding protein (Dickeya dianthicola 67-19) MYLKTSNLPFRERIRRQIDDPIMRQAVANAQERIGANRQKMVDELGQWEVWRTRAAQIRA HVLDNLDAYLYQLSEQVTANGGKVFFAATREDATQYILQVTQAKQARKVVKSKSMVTEEI GMNAVLEAAGIEVVETDLGEYILQLDKDAPSHVVVPAIHKDRHQIQRVLQQQLGYDGPET PEAMTRVIRQKIRTDFLSAEVGITGCNFAVAETGTVSLVSNEGNARLCTTLPRTHIAVMG MERIVPTFDELDVILTMLARSAVGARLTGYNTWLTGPKGRDDVDGPEEFHLVIVDNGRSQ VLGSPFHDILRCIRCGACINTCPAYRHIGGHGYGSIYPGPVGAVLSPLLGGYEDFKHLPY ACSLCTACDDVCPVRIPLSSLILQHRRTLAEQGMTPAAERRAVRLFNYANRHPGVWKVGM VAGAHAARWLIRDGKMPFNLGAISEWTAARDLPDADGESFRSWFKQHQRQTKEKR