Protein Info for HGI48_RS08045 in Dickeya dianthicola 67-19

Annotation: deferrochelatase/peroxidase EfeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR01412: Tat-translocated enzyme" amino acids 24 to 435 (412 residues), 569.2 bits, see alignment E=7.8e-175 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 29 to 52 (24 residues), 18.6 bits, see alignment (E = 2.8e-07) PF04261: Dyp_perox_N" amino acids 76 to 227 (152 residues), 148.8 bits, see alignment E=1.2e-47 TIGR01413: Dyp-type peroxidase family" amino acids 76 to 424 (349 residues), 334.2 bits, see alignment E=1.4e-103 PF20628: Dyp_perox_C" amino acids 241 to 424 (184 residues), 174.7 bits, see alignment E=1.4e-55

Best Hits

Swiss-Prot: 73% identical to EFEB_YERPS: Deferrochelatase/peroxidase EfeB (efeB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 94% identity to ddd:Dda3937_00792)

MetaCyc: 74% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RC87 at UniProt or InterPro

Protein Sequence (437 amino acids)

>HGI48_RS08045 deferrochelatase/peroxidase EfeB (Dickeya dianthicola 67-19)
MSHNTGPRHGPQSSQSSACPAQPDVASPSRRRLLQGLGMMGGALALGADRLAQAQDKPQA
PQDERWEKQPFYGPHQAGIVTPQQAAMMLVAFDVLATSKSELTRLFQLLTQRIAFLTQGG
KVPNADPRLPPLDSGIMGPEIYPDNLTITVSVGASLFDERFGLQALKPLKLQRMTRFPND
SLDASLCHGDLLLQICANTNETVLHALRDIIKQTPDLLSVRWKREGFISAHAARSKGQET
PVNLLGFKDGTANPNTGDSALMDAMLWVGASSGEPAWATDGSYQAARLIRFHVEFWDRTP
LREQQTIFGRDKHSGAPLGMTHEHDEPDYRQDPEGKVIPLDAHIRLANPRTPETRANLML
RRGYSYSLGVSNSGQLDMGLLFVCYQADLEKGFLTVQKRLDGEPLEEYIKPIGGGYFFVL
PGVKRADDWLASGLLMA