Protein Info for HGI48_RS07870 in Dickeya dianthicola 67-19

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 58 to 84 (27 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 182 to 208 (27 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF00950: ABC-3" amino acids 13 to 265 (253 residues), 300.3 bits, see alignment E=6.2e-94

Best Hits

Swiss-Prot: 67% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 97% identity to ddd:Dda3937_00373)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RC53 at UniProt or InterPro

Protein Sequence (275 amino acids)

>HGI48_RS07870 metal ABC transporter permease (Dickeya dianthicola 67-19)
MEWLTLLAEPFAFPFMVKAMLAAGVVGMVCAVLSCFMVLKGWSLMGDAVSHAVLPGVVLA
WLAGIPLAIGAFASGLFCALATGYVKERCRIKEDTVMGILFSGMFAVGLVLFSRVNTEQH
LSHILFGNVLGITRYELQQTLAISLLVLAVVLIKWRDLVLYCFDATQAQVCGLPVKLLHY
GLLTLLSLTIVAALQAVGVILVIAMLITPGITGFVLCKRFGAMMLVAVSTATFSSVFGTW
LSYFLDGATGPCIVIIQSLIFLIAQCAAKMRKSPH