Protein Info for HGI48_RS07655 in Dickeya dianthicola 67-19

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF00890: FAD_binding_2" amino acids 19 to 220 (202 residues), 27.8 bits, see alignment E=4.5e-10 PF01266: DAO" amino acids 19 to 410 (392 residues), 241.6 bits, see alignment E=5.6e-75 PF01134: GIDA" amino acids 19 to 47 (29 residues), 25.1 bits, see alignment (E = 2.7e-09) PF12831: FAD_oxidored" amino acids 19 to 76 (58 residues), 31.9 bits, see alignment 2.9e-11 PF13450: NAD_binding_8" amino acids 22 to 53 (32 residues), 29.4 bits, see alignment (E = 2.5e-10)

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_03026)

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RCC0 at UniProt or InterPro

Protein Sequence (440 amino acids)

>HGI48_RS07655 FAD-binding oxidoreductase (Dickeya dianthicola 67-19)
MPAPIRYVQDSSQLPVQADVVVIGAGIAGVAATYELAKKGVSVLLLEKGLVGGEQSSRNW
GWCRQQNRDERELPLIIYALRRWEELQQETGEELGFRRSGLLYATQDQAEIDAWGTMARA
YGVRSDILNAAQAKAMTPGSTTAWLGGVWSPTDGHAEPALACAGLASAAQRLGASVIQQC
AVRGLDISGGRVSGVWTERGRVKTAMVICAGGAWSSLFCRRHGIELPLGNVIGTAFRTAP
IEQAIGLPFYTGAFACRPQLDGSYTVSVSGRGRLEPGFQSLRYARQFYPTFRARRKNLSF
RPGIKPFLCGPEVWARWAFDDLSPFEKTRILDPAADMTMVSEGLAAMRREYPALAQVRAV
QAWGGMIDSTPDAIPVISPVASLPGLVLSAGFSGHGFGIGPGAGRLAADLATGDVPVVDP
TPYRYARLVDGSGLNAPGMM