Protein Info for HGI48_RS07505 in Dickeya dianthicola 67-19

Annotation: phosphonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 27 to 291 (265 residues), 275.7 bits, see alignment E=1.6e-86 PF00005: ABC_tran" amino acids 45 to 223 (179 residues), 115.9 bits, see alignment E=2.3e-37

Best Hits

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 72% identity to pao:Pat9b_2460)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RC71 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HGI48_RS07505 phosphonate ABC transporter ATP-binding protein (Dickeya dianthicola 67-19)
MAQALLASESATPLRTHHFQTQPQQTILSVRQLCKAYSGQQKRVLDNLSFDLYAGEMVAV
IGRSGAGKSTLLHVMNGTIPASEGQILRYRYPTEQDSEQRDTQDIDTQDIDVQDILRFSS
RQMRQWRSECGMIFQDFCLVPRLDVLTNVLLGRLSRTSTLKSFFKLFSDEDRAHAIGLLQ
WMNLLPHALQRAENLSGGQMQRVAICRALMQNPKILLADEPVASLDPKNTRRIMDVLRQV
SDNGITVVVNLHSVEQVKAYCTRAIGIAQGRILFDGPPSELTDSLLHTLYGDDLQPVH