Protein Info for HGI48_RS07135 in Dickeya dianthicola 67-19

Annotation: lytic transglycosylase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01464: SLT" amino acids 11 to 148 (138 residues), 48.5 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: K03194, type IV secretion system protein VirB1 (inferred from 85% identity to ddd:Dda3937_02755)

Predicted SEED Role

"Bores hole in peptidoglycan layer allowing type IV secretion complex assembly to occur (VirB1)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJX2 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HGI48_RS07135 lytic transglycosylase domain-containing protein (Dickeya dianthicola 67-19)
MLSPTAFLAAAMQCAASIHPSTAFDVAKVESGFNPYAIAEIVPKQERMPGRAGVISHQPT
RHETAVNIINRIEAKGRRYSVGLMQITSTHFQHYGVTARALLDPCTNLSVFERILTDCYQ
RGGTLKRALSCYYSGNFDTGQQPESAFNQTSYIQRLGYEVPSTREDLKHSTSSQSTSDIH
YPTTVLRGELTDKPIPVLTSLHYPDAIIRGDVSLPVINEEK