Protein Info for HGI48_RS06980 in Dickeya dianthicola 67-19

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00106: adh_short" amino acids 4 to 198 (195 residues), 169.8 bits, see alignment E=7.7e-54 PF08659: KR" amino acids 6 to 169 (164 residues), 66 bits, see alignment E=6.5e-22 PF13561: adh_short_C2" amino acids 12 to 248 (237 residues), 183.3 bits, see alignment E=8.5e-58

Best Hits

Swiss-Prot: 65% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to xne:XNC1_4576)

MetaCyc: 35% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RBN5 at UniProt or InterPro

Protein Sequence (249 amino acids)

>HGI48_RS06980 SDR family oxidoreductase (Dickeya dianthicola 67-19)
MNNKVTLITGGDRGIGRATALCLANKGHKICIGYRTREDCAHEVVERIRHSGGEVIAVQV
DISQEEQIVALFKQIDKDLGPVSGLVNNAGMLMPQASIEQLNAQRLATLFATNVSGSFIC
AREAVKRMAHRHGGKGGAIVNVSSAAARLGSPHEYVDYAASKGAIDTLTIGLSLEVASQG
IRVNAVRPGFIYTDMHADGGEAARVDRVKDSLPMKRGGHPEEVAQAIAWLLSDEASYVTG
SFIDLAGGK