Protein Info for HGI48_RS06595 in Dickeya dianthicola 67-19

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 28 to 342 (315 residues), 402.8 bits, see alignment E=4.6e-125 PF02445: NadA" amino acids 32 to 341 (310 residues), 353.9 bits, see alignment E=3.2e-110

Best Hits

Swiss-Prot: 84% identical to NADA_PECCP: Quinolinate synthase A (nadA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 94% identity to ddd:Dda3937_03984)

MetaCyc: 81% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RBF9 at UniProt or InterPro

Protein Sequence (348 amino acids)

>HGI48_RS06595 quinolinate synthase NadA (Dickeya dianthicola 67-19)
MSLFLDPPGINYPFPAKPRRLSEEEKQQHRHRIKGLLKERNAVLVAHYYTDPEIQSLAEE
TGGCVADSLEMARFGRTHPASTLVVAGVRFMGETAKILSPEKTVLMPTLEAECSLDLGCP
VDAFSAFCDSHPERTVVVYANTSAAVKARADWVVTSSIAVELIEHLDSLGETIIWAPDRH
LGNYVQKQTGADVLCWQGACIVHDEFKTQALKRMKALYPQAAVLVHPESPQSIVAMADAV
GSTSQLIQAAKQLPHRELIVATDRGIFYKMQQACPDKVLLEAPTAGEGATCRSCAHCPWM
AMNGLQAIASALEQQDTRHHAIKVDADVRERALVPLNRMLDFAAKLRS