Protein Info for HGI48_RS05550 in Dickeya dianthicola 67-19

Annotation: DUF3251 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF11622: DUF3251" amino acids 22 to 179 (158 residues), 178.6 bits, see alignment E=4.7e-57

Best Hits

Swiss-Prot: 35% identical to YAJI_ECOLI: Uncharacterized lipoprotein YajI (yajI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to ddd:Dda3937_01952)

Predicted SEED Role

"Hypothetical lipoprotein yajI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RAZ3 at UniProt or InterPro

Protein Sequence (191 amino acids)

>HGI48_RS05550 DUF3251 domain-containing protein (Dickeya dianthicola 67-19)
MIFHRRVISMLSVMVLLAGCAQPQPPRIQNELGQINQKLRDLTNRTVALEQQNTLNANST
SGVYLLPAAHNRALLDSSIGKLSLELSKAEPEASGTRALLTIRTMNTLTLPAFRAQLDWG
ALDPVSGKPLASDTQTQLLTIPPMLTPVSEITVSEITIEVRLSGLTPEQLGFVRMHDVAA
DPTLRRSEPSQ