Protein Info for HGI48_RS04215 in Dickeya dianthicola 67-19

Annotation: nucleotidyl transferase AbiEii/AbiGii toxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF08843: AbiEii" amino acids 36 to 279 (244 residues), 108.1 bits, see alignment E=3.5e-35

Best Hits

KEGG orthology group: None (inferred from 92% identity to pwa:Pecwa_0953)

Predicted SEED Role

"conserved hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RAJ2 at UniProt or InterPro

Protein Sequence (305 amino acids)

>HGI48_RS04215 nucleotidyl transferase AbiEii/AbiGii toxin family protein (Dickeya dianthicola 67-19)
MNQKVNFAELVSKAMESAELEGLRNVVEKELLHYDILYCLDSAGLLEQLTFQGGTSLRLC
HGGNRFSEDLGFAGGIAFSGADLKNMKTCIEEYLGGRYGLEVNVKEPHELRHEPGYEEVR
IDKWQVSVTTAPEKRDMPRQRVKIEIANIPAYTRTPMALKRNYDVLPDGYSDTLVMCETL
NEVMCDKLVSLVATTKYIRYRDVWDLPWLIQQNATYDLDLIRKKIQDYRIPNYADLLAQR
IQSIEQIVGDGRFSAEMRRFLPQAVFDRTLGREAFSQYLSGELKTLLSTLQQELKGQGGK
APFIM