Protein Info for HGI48_RS01760 in Dickeya dianthicola 67-19

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02417: D-fructose-responsive transcription factor" amino acids 8 to 319 (312 residues), 404.8 bits, see alignment E=1.5e-125 PF00356: LacI" amino acids 8 to 56 (49 residues), 58.4 bits, see alignment 9.8e-20 PF00532: Peripla_BP_1" amino acids 68 to 240 (173 residues), 33.8 bits, see alignment E=5.2e-12 PF13377: Peripla_BP_3" amino acids 181 to 333 (153 residues), 54.5 bits, see alignment E=3.2e-18

Best Hits

Swiss-Prot: 66% identical to SCRR_KLEPN: Sucrose operon repressor (scrR) from Klebsiella pneumoniae

KEGG orthology group: K03484, LacI family transcriptional regulator, sucrose operon repressor (inferred from 97% identity to ddd:Dda3937_01265)

Predicted SEED Role

"Sucrose operon repressor ScrR, LacI family" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9C5 at UniProt or InterPro

Protein Sequence (343 amino acids)

>HGI48_RS01760 LacI family DNA-binding transcriptional regulator (Dickeya dianthicola 67-19)
MKQTKRVTISDIAQLAGVSKSTASLVLNGRSKEFRVSDETRDRVLALAQQHRYQPSIHAR
SLRSSRSNTLGLVVPEMTNYGFAMISRELECLCREAGLQLLIACTDENASQEMMAVNSLI
QRQVDGLIVASSMLSDAEYQKINQQLPVLQFDRVIGESDLPMVVSEAVESTAMLVENIAR
RHPDEFYFIGGPPRISPTRDRLAGFQLGLERAGVECRPEWIIHGNYHSSAGYEMFAQLCA
RLGRPPKALFTAACGLLEGVLRYLNQHHLMDCNMRLCSFDDHYLFDCLPLKIDTVAQDCE
TLARNSFEMINALIEGQPLTESRVYVPTRPHWRHPDSRADTHR