Protein Info for HER17_RS20880 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 98 to 124 (27 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 178 (17 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 72 (52 residues), 56 bits, see alignment 2.9e-19 PF00528: BPD_transp_1" amino acids 114 to 298 (185 residues), 97.6 bits, see alignment E=7.7e-32

Best Hits

Swiss-Prot: 58% identical to GSID_SALCH: Glutathione transport system permease protein GsiD (gsiD) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 98% identity to pct:PC1_4111)

MetaCyc: 57% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>HER17_RS20880 ABC transporter permease subunit (Pectobacterium carotovorum WPP14)
MNLPPEPVVAVATLDEETIRSPWRDFVQVFIRNPMALVSSGFVLLLVLVAIFAPWLAPWN
PMEPDWASLASPPSAAHWMGTDDLGRDVMSRIIYGARISLYIGIFSVTLGMLVGIVLGLL
AGYYGRWVDTLIMRGSDVLFAFPGMLLAIAVVAILGPGLNNVIIAVAVFSVPVFARIVRA
STLSLKQAAYVEAVRCAGAPDRIVLMRHILPGTLPNVIVYFTMRIGTSILTAAGLSFIGL
GPEPDVPEWGNILAMSRSLMMAGAWHVSVFPGLAIFFTVLAFNLLGDALRDTLDPKLKS