Protein Info for HER17_RS20845 in Pectobacterium carotovorum WPP14

Annotation: nucleoid occlusion factor SlmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF00440: TetR_N" amino acids 25 to 61 (37 residues), 33.8 bits, see alignment 1.2e-12

Best Hits

Swiss-Prot: 100% identical to SLMA_PECAS: Nucleoid occlusion factor SlmA (slmA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05501, TetR/AcrR family transcriptional regulator (inferred from 100% identity to eca:ECA0142)

Predicted SEED Role

"Transcriptional regulator SlmA, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>HER17_RS20845 nucleoid occlusion factor SlmA (Pectobacterium carotovorum WPP14)
MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSEAALYRHFPSKTRMFD
SLIEFIEDSLTTRINLILQDEKETFNRLRLILLLILGFAERNPGLTRIMTGHALMFEQDR
LQGRINQLFERIESQLRQVLREHKLRDGKGFQHDETVLASQLLAFCEGMLSRFIRSEFRY
RPTQEFDTRWPLLAAQLN