Protein Info for HER17_RS20635 in Pectobacterium carotovorum WPP14

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01892: acetylornithine deacetylase (ArgE)
  • amino acids 10 to 377 (368 residues), 519.2 bits, E=3e-160
• PF01546: Peptidase_M20
  • amino acids 76 to 377 (302 residues), 111.5 bits, E=5.4e-36
• PF07687: M20_dimer
  • amino acids 178 to 285 (108 residues), 85.2 bits, E=2.9e-28

Best Hits

Swiss-Prot: 99% identical to ARGE_PECCP: Acetylornithine deacetylase (argE) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 98% identity to eca:ECA0191)

MetaCyc: 83% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Protein Sequence (383 amino acids)

>HER17_RS20635 acetylornithine deacetylase (Pectobacterium carotovorum WPP14)
MKMNLPPFIELYRALIATPSISATDSALDQSNHTLINLLAGWFGDLGFHVEVQPVPGTLN
KFNMLARIGEGKGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFI
LDALRDIDPTKLTKPLYVLATADEETTMAGAKYFSESTQIRPDCAIIGEPTSLQPVRAHK
GHMSNAIRIQGQSGHSSDPSRGVNAIELMHEAISHLLVLRNTLQERYHNPIFHIPHPTMN
LGHIHGGDAANRICGCCELHMDIRPLPGITLNDLDGLLSEALEPVSQRWPGRLTISELHP
PIPGYECPPDHRLVSVVENLLGTKTEIVNYCTEAPFIQTLCPTLVLGPGSIEQAHQPDEY
IDTKFIKPTRDLISQVIHHFCHH