Protein Info for HER17_RS20490 in Pectobacterium carotovorum WPP14

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF00583: Acetyltransf_1" amino acids 40 to 143 (104 residues), 48.6 bits, see alignment E=1.8e-16 PF13673: Acetyltransf_10" amino acids 48 to 148 (101 residues), 45.8 bits, see alignment E=1.2e-15 PF13508: Acetyltransf_7" amino acids 60 to 144 (85 residues), 49.7 bits, see alignment E=8e-17

Best Hits

Swiss-Prot: 47% identical to TTR_PSEAJ: Acetyltransferase (ttr) from Pseudomonas amygdali pv. tabaci

KEGG orthology group: None (inferred from 91% identity to pct:PC1_0197)

MetaCyc: 47% identical to tabtoxinine-beta-lactam acetyltransferase (Pseudomonas syringae)
2.3.1.-

Predicted SEED Role

"Putative acetyltransferase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>HER17_RS20490 GNAT family N-acetyltransferase (Pectobacterium carotovorum WPP14)
MKTVQLNAATLPVYREELANLLIDAVEKGASVGYHSPLSHKEATEYFHSLQTSVSNGERM
IWVARDEEGIVGSVQLELCQKTNGKNRAEIQKLLVHSRTRRAGIGRLLIQLLEKSALLQQ
RGLLYLDTQAGSPAEAFYRALGYRHLGELPDYACTPDGYYHPTAIYYKRLFAVNGLGKAI
AS