Protein Info for HER17_RS20280 in Pectobacterium carotovorum WPP14

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 34 to 251 (218 residues), 212.2 bits, E=7e-67
• PF12974: Phosphonate-bd
  • amino acids 119 to 237 (119 residues), 27.1 bits, E=2.9e-10

Best Hits

Swiss-Prot: 47% identical to Y1080_HAEIN: Probable amino-acid ABC transporter-binding protein HI_1080 (HI_1080) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 97% identity to pct:PC1_0231)

Predicted SEED Role

"Cystine-binding periplasmic protein precursor"

Protein Sequence (255 amino acids)

>HER17_RS20280 amino acid ABC transporter substrate-binding protein (Pectobacterium carotovorum WPP14)
MKKIRFALLTSALLATSVFAHADDLSAIKSAGVIKIGTEGTYAPYTYHDKSGQLVGFDVD
IGRAVAEKLGVKAQFIEGRWDGLIAGIDAKRYDAVINQVGVTKERQAKYDFSKPYIDSKA
VLVVRGDNTTIKDFSDLKGKKSAQSLTSNYSKQATSYGAEIVPTDGFNQSLDLVLSGRAD
ATLNDNLSFLDFKKQKPDANVKIAATSKDGEPSAILVRKDQAPLVEALNKALDEIKADGT
YKTISVRYFGEDVSQ