Protein Info for HER17_RS20155 in Pectobacterium carotovorum WPP14

Annotation: Maf-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00172: septum formation protein Maf
  • amino acids 2 to 181 (180 residues), 208.2 bits, E=3.7e-66
• PF02545: Maf
  • amino acids 3 to 184 (182 residues), 212.1 bits, E=2.9e-67

Best Hits

Swiss-Prot: 96% identical to NTPPA_PECAS: dTTP/UTP pyrophosphatase (ECA0270) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06287, septum formation protein (inferred from 98% identity to pct:PC1_0255)

MetaCyc: 69% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• dZTP biosynthesis (3/5 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Protein Sequence (197 amino acids)

>HER17_RS20155 Maf-like protein (Pectobacterium carotovorum WPP14)
MTQLYLASASPRRRELLTQLDIPFSVLNVAVEEQRLPEEAAEVYVRRLAHEKAAAGVAAA
PSDLPVLGADTIVVLNGQVLEKPQDEAHAAEMLSQLSGKSHQVMTAVALADKDDVLSCLV
ITDVVFRPLSQQDIERYIASGEPMDKAGAYGIQGKGGCFVRSLNGSYYAVVGLPLVETYE
LFSNFAALRSARGKHDC