Protein Info for HER17_RS20035 in Pectobacterium carotovorum WPP14

Annotation: arabinose-5-phosphate isomerase KdsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF01380: SIS" amino acids 82 to 212 (131 residues), 105.5 bits, see alignment E=1.9e-34 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 85 to 353 (269 residues), 402.3 bits, see alignment E=5.5e-125 PF00571: CBS" amino acids 241 to 296 (56 residues), 26.4 bits, see alignment E=7.4e-10 amino acids 308 to 360 (53 residues), 32.8 bits, see alignment 7.4e-12

Best Hits

Swiss-Prot: 82% identical to KDSD_YERPE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Yersinia pestis

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 99% identity to pct:PC1_0279)

MetaCyc: 78% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>HER17_RS20035 arabinose-5-phosphate isomerase KdsD (Pectobacterium carotovorum WPP14)
MSQFEQDAHLKQQSDRALSDHAPQADHAPQADHTRQKAHELPADFDFQQAGKQVLSIERD
GLAQLDQYIDDNFTLACKKIFDCQGKVVVMGMGKSGHIGCKIAATFASTGTPAFFVHPGE
ASHGDLGMVTPHDIVIAISNSGESHEILSLIPVLKRQKVFLICMTSAPESTMGKAADIHL
CVHVPQEACPLGLAPTTSTTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLR
VSDIMHSGDEIPHVPHDASLRDALVEITRKNLGMTVICEADMKIQGIFTDGDLRRIFDMN
IDLNSARIADVMTAGGIRVAPQTLAVDALNLMQSRHITSVLVAENDRLVGIVHMHDMLRA
GVV