Protein Info for HER17_RS19955 in Pectobacterium carotovorum WPP14

Annotation: alcohol dehydrogenase catalytic domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF08240: ADH_N" amino acids 31 to 143 (113 residues), 103.6 bits, see alignment E=8.2e-34 PF16912: Glu_dehyd_C" amino acids 155 to 275 (121 residues), 35.5 bits, see alignment E=1.1e-12 PF00107: ADH_zinc_N" amino acids 184 to 309 (126 residues), 86.7 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 48% identical to IDND_ECOLI: L-idonate 5-dehydrogenase (NAD(P)(+)) (idnD) from Escherichia coli (strain K12)

KEGG orthology group: K00098, L-idonate 5-dehydrogenase [EC: 1.1.1.264] (inferred from 72% identity to pam:PANA_0594)

MetaCyc: 48% identical to L-idonate 5-dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-idonate 5-dehydrogenase. [EC: 1.1.1.264]

Predicted SEED Role

"L-idonate 5-dehydrogenase (EC 1.1.1.264)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.264)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.264

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>HER17_RS19955 alcohol dehydrogenase catalytic domain-containing protein (Pectobacterium carotovorum WPP14)
MKQDTLTFDACIVHGKKDVKVESRELTYTENDIVVNVECGGICGSDIHYYHEGHAGLSVI
KHPMVIGHEFVGRIHQAPKNSQLKVGQKVAINPSQPCNQCTYCLEGKQNECQSMRFMGSA
QFNPHVHGGFAQYVTVSAQQCYPYDENVPSQIMALAEPTAVVIHAINVAGSLVGKKVLVI
GAGPIGALTIAAAKASGAVEIVASDISERCRNIALEMGADASVNPLDESAMEIYNQNKGY
FDVTFEASGAPAAIASSVFATRPNGLIVQIGMGPSPVHYPVAQMLVKELSWKGSFRFINE
FATAVKWLEKGIINPQPIISAEYSYHDVENALIAASDKNISSKVLVKF