Protein Info for HER17_RS19775 in Pectobacterium carotovorum WPP14

Annotation: PTS fructose transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 117 (29 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details TIGR01427: PTS system, Fru family, IIC component" amino acids 10 to 335 (326 residues), 303.8 bits, see alignment E=9.4e-95 PF02378: PTS_EIIC" amino acids 19 to 273 (255 residues), 50.3 bits, see alignment E=9.6e-18

Best Hits

Swiss-Prot: 38% identical to PTFC_HALVD: PTS system fructose-specific EIIC component (ptfC) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K02770, PTS system, fructose-specific IIC component (inferred from 98% identity to pwa:Pecwa_0333)

Predicted SEED Role

"PTS system, fructose-specific IIBC component (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>HER17_RS19775 PTS fructose transporter subunit IIC (Pectobacterium carotovorum WPP14)
MNTRKITVGQEIKRHLLTGISWMIPLIVAAGICIALGQVIGGPDVGKQTGSIAWMLNQIG
GWGMGLIVPLISAAIAYSIADRPGFAPGLIVGFICGQIQTGFIGGILGGFLVGYTVLLLR
RYIKLPTSMQGLMPVMILPLISTIIAGLLMMTFIGQPIVWLQKSLIHLLESMQGGSKFLM
GAILGAMATFDFGGPVNKTMSLFADGMLVDGIYGPEAVKFVGSMIPPFGITFSFLLTRYK
YTRAEKEALKAAFPMGICMITEGVIPIAARDLFRVVASCVVASAIAGGLIMVWGVEAPVP
HGGMFVVPLFTKPLMFCLALGIGTVICGVMLSLIKKRVTQADEEFDDVDDSSVRDEDIKF
TLE