Protein Info for HER17_RS19670 in Pectobacterium carotovorum WPP14

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 114 to 136 (23 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 103 to 314 (212 residues), 330.2 bits, see alignment E=3e-103 PF01618: MotA_ExbB" amino acids 195 to 296 (102 residues), 109.9 bits, see alignment E=3.7e-36

Best Hits

Swiss-Prot: 57% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 98% identity to pct:PC1_0345)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>HER17_RS19670 tol-pal system-associated acyl-CoA thioesterase (Pectobacterium carotovorum WPP14)
MKTAVSNTTQQVLSTWQKKRGAFSAFSRSVLVILLCTAGLSGNAFAAPATAPLSTENAAP
AVQPAAASPSAPVTTDAQAPASALALPASAAPGTNNLMKTDLSVWGMYQHADAVVKTVMI
GLLLASVITWAIFFSKSVEMSGAKRRLRREYLALEQAKTLDDALETADAFKAGSVAQQLL
VDAQNELELSARSDDNNGIKERTAFRLERRVAATGRHMGRGNGYLATVGAVAPFVGLFGT
VWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSIASYKAM
VGDVAAQVLLLQSRDLDVAASNDNRASSAAHKLRVG