Protein Info for HER17_RS17555 in Pectobacterium carotovorum WPP14

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13673: Acetyltransf_10
  • amino acids 53 to 144 (92 residues), 32.2 bits, E=1.5e-11
• PF00583: Acetyltransf_1
  • amino acids 54 to 141 (88 residues), 68.6 bits, E=8.9e-23
• PF13508: Acetyltransf_7
  • amino acids 57 to 141 (85 residues), 43.9 bits, E=3.9e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to pct:PC1_0703)

Predicted SEED Role

"GCN5-related N-acetyltransferase (EC 2.3.1.57)" (EC 2.3.1.57)

MetaCyc Pathways

• putrescine degradation III (2/4 steps found)
• spermine and spermidine degradation I (2/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.57

Use Curated BLAST to search for 2.3.1.57

Protein Sequence (165 amino acids)

>HER17_RS17555 GNAT family N-acetyltransferase (Pectobacterium carotovorum WPP14)
MNITSINIVIRPAQKSDASVILDLIIELAVYEKARHEVLASLEDIERSLFGEGATAETLI
CEIDGKPVGYAIFFMSYSTWLGKYGIYLEDLYIAQAYRQAGAGKALLKQVARLAQERQCG
RLEWSVLDWNQPAIDFYKSIGAKPQDEWVRYRMDEKGIADFVTAS