Protein Info for HER17_RS17240 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 25 to 276 (252 residues), 158.1 bits, see alignment E=4.5e-50 PF05992: SbmA_BacA" amino acids 31 to 342 (312 residues), 130.5 bits, see alignment E=1.4e-41 PF00005: ABC_tran" amino acids 374 to 507 (134 residues), 62 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 93% identity to eca:ECA0880)

Predicted SEED Role

"SbmA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>HER17_RS17240 ABC transporter ATP-binding protein/permease (Pectobacterium carotovorum WPP14)
MKKIAAQFVDLCRPFWRGKQGLLALLLLVAAISMGWTIVYLNVLLNDWSKTFYDALGTFD
SSLLLSLMKEYGIYILIYIVVFVHQDWFTRWLIIRWRSAMTEELVNSWLAKRAFYRMSIV
GKIDNPDQRIAEDISLFVDKTVSLVASFLVVTAQLSSFVIILWELSGVQRFTLFGEEWVI
KGYLVWAVIIYTVFGTLITHLIGKRLHGINYEKQRAEANFRASLLRKHDNAEQIALYGGE
QQEKSHLKRQFSAIVSNWWRSMNAERNLGFFTTGYMRVSLIVPIFAALPAFLSKTVTLGG
LMQIRGAFAQVHGALSWFIRMYREFMELSASMERLSQFKQEIKRHQSEDEVVPVGERLQL
DQLSFTTPQGSPLLQKVDLSCEAGSWSKFSGRSGLGKSTLLRTLSGLWPYYDGRWQSLEG
RSLLLPQQSYLGQGTLAEILCYPHPALADSDMLRQTLDSVGLGAWRDRLDEQLNWDRVFS
GGERQRVAFARALIAKPDTLYLDEATSNLDHDAARQLLALVKLALPACTVVAITHQTELD
DLFTHRYDLTDFASQRS