Protein Info for HER17_RS17150 in Pectobacterium carotovorum WPP14

Annotation: ubiquinone biosynthesis accessory factor UbiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF04380: BMFP" amino acids 1 to 78 (78 residues), 95.2 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 81% identical to UBIK_ECOLI: Ubiquinone biosynthesis accessory factor UbiK (ubiK) from Escherichia coli (strain K12)

KEGG orthology group: K09806, hypothetical protein (inferred from 97% identity to pct:PC1_0780)

MetaCyc: 81% identical to ubiquinone biosynthesis accessory factor UbiK (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uncharacterized protein yqiC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>HER17_RS17150 ubiquinone biosynthesis accessory factor UbiK (Pectobacterium carotovorum WPP14)
MIDPKKIEQIARQVHESMPKGIRELGDDVEKKIRQVLQAQLTRLDLVNREEFDIQTQVLL
RTREKIARLEQRMTELEAKLSTEEKPAASPENDQSS