Protein Info for HER17_RS17085 in Pectobacterium carotovorum WPP14

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 37 to 224 (188 residues), 38.8 bits, see alignment E=3.2e-13 PF01134: GIDA" amino acids 37 to 229 (193 residues), 28.1 bits, see alignment E=4.5e-10 PF00890: FAD_binding_2" amino acids 37 to 478 (442 residues), 209.2 bits, see alignment E=5.1e-65 PF01266: DAO" amino acids 37 to 226 (190 residues), 46.9 bits, see alignment E=1.2e-15 PF03486: HI0933_like" amino acids 37 to 223 (187 residues), 22.9 bits, see alignment E=1.4e-08 PF12831: FAD_oxidored" amino acids 37 to 220 (184 residues), 43.7 bits, see alignment E=9.8e-15 PF13450: NAD_binding_8" amino acids 40 to 73 (34 residues), 25.9 bits, see alignment (E = 3.9e-09)

Best Hits

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 98% identity to pct:PC1_0795)

Predicted SEED Role

"Fumarate reductase flavoprotein subunit (EC 1.3.99.1)" in subsystem Succinate dehydrogenase (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>HER17_RS17085 FAD-dependent oxidoreductase (Pectobacterium carotovorum WPP14)
MKRFRKSVLATLCLSMMSWSTAQAADAAKPEIPKSADIVIIGAGAAGTSATMAAAEKGAK
IVLLEKQPIVGGTGNFAEGIFAANSSMQKRQGIVVTPDMAFKTIMEYSHWMANPFVVRAF
VNRSADTIEWVKSKGIKFEYIGPGGPGGMLTWHVIDGPGHGRHLIKTFHEQFKTMDVTTL
VKTAGKDLVVKDGKVTGVIAQDSEGNTVQIDAKAVIIATGGYANNKEMLQKYAAFPDTIM
VGNVGKDGDGINMAWKAGAKPDGLGLLQAYRPGLPDYAPNSHLLAAARQPYLWVDQHGRR
FTDESNVIIWPHSGNALSKAGGIMYSIFDETSRKHYVEDGIDVPIGEWVIANTKLTKFDS
EFTKESQKNRGFVFKSATIDGLAKEMGVDASVLKNTLEENNKFATQKRDEVFNKNMDYLR
PVKTGPFYAVRMQPAALGTLGGVKIDEKMQAIDKSGEVIPGLYVTGNDAAGMYGDTYDLL
LGGGTFGFALNSGRIAAESALDYMKFSKK