Protein Info for HER17_RS16950 in Pectobacterium carotovorum WPP14

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 396 (365 residues), 143.6 bits, see alignment E=3.9e-46

Best Hits

KEGG orthology group: None (inferred from 96% identity to eca:ECA0937)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>HER17_RS16950 MFS transporter (Pectobacterium carotovorum WPP14)
MTTTTTVSSAHTREAHLASAIAKFFKRIIPMLAVMLIINQIDRSNIGFIKAELQTDAGIS
AAAFGLGAGLFFIGYALFEVPSNLMMKKFGARVWLTRIMITWGAVVVATGFVTSPIQFYV
LRFLLGVAEAGFFPGVLYYFRLWVPNAWRGRATALILSASAGAFLFSGPITGAILMMHDF
LGIAGWKWVMFLEGAGSILVGILAAFVLVSSPDKARWLSAEEKQALEQQLQQEEIERDAQ
QENTGKLRLLTDRRTLFYCAIFFTMTMTGYTLVFWLPQIIQRIQGFSSFGIGLLTAIPWL
CAIIAINLVSKFSDKHRQHLPKALGVAMLIAACGTFMATIGSPWFGFLAMIVACIGSKVS
ATFFWPMPQGNLPASIVAPGIALINSIGNLGGFVAPTVFGYLELKTGSTTGGLYSLTAVS
VVTGLFLLLRSTHATPPSSFKPMEHRNV