Protein Info for HER17_RS16505 in Pectobacterium carotovorum WPP14

Annotation: amino-acid N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR01890: amino-acid N-acetyltransferase" amino acids 14 to 447 (434 residues), 652.5 bits, see alignment E=1.6e-200 PF00696: AA_kinase" amino acids 31 to 273 (243 residues), 122.1 bits, see alignment E=4.8e-39 PF00583: Acetyltransf_1" amino acids 332 to 418 (87 residues), 37.6 bits, see alignment E=3.7e-13 PF13508: Acetyltransf_7" amino acids 341 to 418 (78 residues), 32.1 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 99% identical to ARGA_PECAS: Amino-acid acetyltransferase (argA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 98% identity to pwa:Pecwa_3385)

MetaCyc: 86% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>HER17_RS16505 amino-acid N-acetyltransferase (Pectobacterium carotovorum WPP14)
MQRGLAVKERSTELVQGFRHSVPYINAHRGKTFVIMLGGEAIEHANFSSIVNDIGLLHSL
GIKLVVVYGARPQIDANLTTHHYEPHYHKNTRITDSATLELVKQAAGMLQLDITARLSMS
LNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEEAVHRQLNSGAIVLLGP
VAVSVTGESFNLTSEEVATQLAIKLKAEKMIGFCSSQGVTNKEGNIISELFPDDAQQRID
ALEQTGDYHSGTVRFLRGAVKACRSGVRRSHLISYQDDGALLQELFSRDGIGTQIVMESA
EQVRRATINDIGGILELIRPLEEQGILVRRSREQLEMEIDKFTVVVRDNLTIACAALYPF
PEESIGEMACVAVHPDYRSSSRGDMLLLRVAAQARQQGLQKLFVLTTHSIHWFQERGFLP
AEVEMLPKKKQALYNYQRRSKILVLDL