Protein Info for HER17_RS16400 in Pectobacterium carotovorum WPP14

Annotation: flap endonuclease Xni

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02739: 5_3_exonuc_N
  • amino acids 5 to 142 (138 residues), 105.6 bits, E=2.4e-34
• PF01367: 5_3_exonuc
  • amino acids 160 to 250 (91 residues), 98.9 bits, E=2e-32

Best Hits

Swiss-Prot: 95% identical to XNI_PECCP: Flap endonuclease Xni (xni) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01146, protein Xni (inferred from 94% identity to eca:ECA1018)

Predicted SEED Role

"DNA polymerase I (EC 2.7.7.7)" in subsystem DNA-replication or DNA Repair Base Excision (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (260 amino acids)

>HER17_RS16400 flap endonuclease Xni (Pectobacterium carotovorum WPP14)
MSVHLLIVDALNLIRRIHAVQGSPCITACQHALHQLIQNSQPTHAVAVFDDEDRDTSWRH
QLLPDYKAGRTPMPENLKQELPQIKAAFAAVGVASWHSPGNEADDLAATLAVKLSSAGHQ
ATIVSTDKGYCQLLAPHIQIRDYFQKRWLDLPFIEQEFGVSPQQLTDYWGLAGISSSKIP
GVAGIGPKSAAQLLQQAGSLEALYQQLDTVPEKWRKKLEQHKEMALISRQIATLRTDLTL
NGNLQQLRLPVQNSAPPHSH