Protein Info for HER17_RS16275 in Pectobacterium carotovorum WPP14

Annotation: acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 4 to 33 (30 residues), 27.2 bits, 2.2e-10
  • amino acids 17 to 52 (36 residues), 33.6 bits, 2.2e-12
  • amino acids 109 to 143 (35 residues), 35.6 bits, 5.2e-13
• TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase
  • amino acids 8 to 260 (253 residues), 359.7 bits, E=3.5e-112
• PF13720: Acetyltransf_11
  • amino acids 180 to 261 (82 residues), 100.4 bits, E=6.1e-33

Best Hits

Swiss-Prot: 99% identical to LPXA_PECCP: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 98% identity to eca:ECA1043)

MetaCyc: 86% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (17/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Protein Sequence (262 amino acids)

>HER17_RS16275 acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Pectobacterium carotovorum WPP14)
MIDQTAFIHPSSIVEDGAIIGAGVHIGPFCYIGSQVEIGAGTVLKSHVVVNGVTKIGRDN
EIYQFTSIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTTQGGGLTKVGSDNLLMIN
THIAHDCVVGSRCILANNATLGGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQD
VPPYVIAQGNHATPFGLNIEGLKRRGFEKDTLHAIRNAYKLLYRSGKTLDEVKPEIEALA
AEYPAVQAFTDFFARSTRGIIR