Protein Info for HER17_RS16030 in Pectobacterium carotovorum WPP14

Annotation: phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 25 to 296 (272 residues), 219.7 bits, see alignment E=2.5e-69 PF12849: PBP_like_2" amino acids 26 to 282 (257 residues), 103.9 bits, see alignment E=1.3e-33 PF13531: SBP_bac_11" amino acids 34 to 293 (260 residues), 32.3 bits, see alignment E=9.1e-12

Best Hits

Swiss-Prot: 54% identical to PSTS_PSEAE: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 97% identity to pct:PC1_1010)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>HER17_RS16030 phosphate ABC transporter substrate-binding protein (Pectobacterium carotovorum WPP14)
MTSATRIAGAFLLLLSALCSAQPRQMLAGNLSSAGSDTLANLMAFWAADFSQHYPNVNLQ
IQAAGSSSAPTSLASGAAQLGPMSRAMKASEIEAFVQHYGYPPLAVPVAMDALVVLVNQD
NPLPGLNLSQLDAIFSITQRCGNHQPIKQWGDLGLHGSWEKRTLLRYGRNSASGTYGFFK
QKALCRGDFLPQVNELPGSASVVQAVAASTDAIGYASVGFRTSGVRMLPLAAQGTDYIYP
STENIRSGLYPYTRYLYIYVNKAPSQPLEALTAAFLARVLSETGQALVNQDGYLPLPEET
RRQARQLIGLPE