Protein Info for HER17_RS15540 in Pectobacterium carotovorum WPP14

Annotation: o-succinylbenzoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21508: MenC_N
  • amino acids 1 to 95 (95 residues), 134.3 bits, E=1.4e-43
• TIGR01927: o-succinylbenzoate synthase
  • amino acids 7 to 307 (301 residues), 381.2 bits, E=1.9e-118
• PF13378: MR_MLE_C
  • amino acids 126 to 280 (155 residues), 56.1 bits, E=4.3e-19

Best Hits

Swiss-Prot: 95% identical to MENC_PECCP: o-succinylbenzoate synthase (menC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02549, O-succinylbenzoate synthase [EC: 4.2.1.113] (inferred from 95% identity to eca:ECA1214)

MetaCyc: 67% identical to o-succinylbenzoate synthase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate synthase. [EC: 4.2.1.113]

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• superpathway of chorismate metabolism (53/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.113

Use Curated BLAST to search for 4.2.1.113

Protein Sequence (323 amino acids)

>HER17_RS15540 o-succinylbenzoate synthase (Pectobacterium carotovorum WPP14)
MRQVTLYRYSVPMEAGVVLRNQRLKTRDGLIVRLQDGERLGWGEIAPLPEFSVETLAEVE
SAALEQLQSWAAGQAFSGDLPPSVAFGLSCAQAELDQHLPQAADYRKAPLCSGDPDELFE
MLQAMPGEKVAKIKVGLYEAVRDGMIVNVLLEALPDLKLRLDANRSWTRAKADGFARYVA
PSLRSRIAFLEEPCKTREESREFARETGINIAWDESVREADFRVEAEPGVSAIVIKPMLV
GSLARCQQLVQETHQAGLTAVISSSIESSLGLTQLARLAHWLTPDTVPGLDTLDLMQAQV
VQHWPDSALPLLAAEQLDVVWQS