Protein Info for HER17_RS15350 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 279 to 292 (14 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 30 to 293 (264 residues), 155.3 bits, see alignment E=3.4e-49 PF05992: SbmA_BacA" amino acids 72 to 347 (276 residues), 60.6 bits, see alignment E=2.8e-20 PF00005: ABC_tran" amino acids 387 to 518 (132 residues), 68 bits, see alignment E=2.1e-22

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 90% identity to eca:ECA1276)

Predicted SEED Role

"ABC transporter ATP binding component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (593 amino acids)

>HER17_RS15350 ABC transporter ATP-binding protein/permease (Pectobacterium carotovorum WPP14)
MNASETSTTRPGIGQILMPYWQTPEKYLALFILVVIISINLGTAYISVEANRISGKFTDA
LIGLDWEQIKPLFIFSFILGLSAMMLRWVNVLGQGYLALRWRTWMTLHYIRRWTGTSAYY
EIERDGALSNIDQRIADDVNELVSASLNFFLSLISVVISTVTYTALLWSVSGVLRFSFMG
SDWAISGYMVYALYIEYFLQILLSHWLGKALIKLNMNQQNAEGDFRFLGVQLRENAEQIA
FYQGGPREGERLAQRFARVRDNALSVLLRGFKVSFGQSLFSHFLSPLPTLLALPQLLRGE
ISFGDLTRIQMAYGSLGATLSYFMQAYQAFTRWLALTKRLQDMEEALNKSEQSPSPIRVT
EHDGSEFSCQGLRLLTPDGRALTALHDWQVLPGERWMINGASGVGKSTLLRACAGLWHHG
SGAITRPRRCRYLFLPQKSYLPTGSLKAALCYPANEQDFTDEQCRQVLIDSELPDIASQL
NVEDRWQQRLSGGEQQRVAIARTLLHRPDFLFLDEATSALDPETEQRVYQALVTGLPDSA
IISVAHREALAALHTHHLHLTPLAESDSRHESETATGDEAPQPQASERVFYAS