Protein Info for HER17_RS12555 in Pectobacterium carotovorum WPP14

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 22 to 170 (149 residues), 131.9 bits, E=4e-42
• PF09383: NIL
  • amino acids 261 to 335 (75 residues), 65.4 bits, E=5.2e-22

Best Hits

Swiss-Prot: 96% identical to METN2_PECAS: Methionine import ATP-binding protein MetN 2 (metN2) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 96% identity to pct:PC1_1681)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Protein Sequence (338 amino acids)

>HER17_RS12555 methionine ABC transporter ATP-binding protein (Pectobacterium carotovorum WPP14)
MIQLEGVSVDFSQGKQPENLAVDNVSLHIQRGEVYGIVGTSGAGKSTLLRTINLLQRPTA
GRVLVNGVLISELAGQPLREQRQKIGMIFQHFNLMQTRTVAENVALSLKAAGKSSADIAA
RVPEILNLVGLTDKALSYPAQLSGGQKQRVGIARAIANDPEVLLCDEPTSALDLETSAAI
LALLKEINEKLGITIVLISHEMSVIKAVCDRVAVMTGGRVVEEGDVFDIFATPQHAFTRQ
LVSHTLDLALPPRLLVDLQGTLLKILFVGESAEQPVLSDVATRFGVSVNILHGKIEYIGN
RALGILVALLTHPSDPGKVTEAVEHIQVRTANVEVLHG