Protein Info for HER17_RS11540 in Pectobacterium carotovorum WPP14

Annotation: PD40 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF14583: Pectate_lyase22" amino acids 1 to 386 (386 residues), 852.9 bits, see alignment E=2.5e-261 PF07676: PD40" amino acids 356 to 378 (23 residues), 20.2 bits, see alignment (E = 4.5e-08)

Best Hits

Swiss-Prot: 98% identical to OGL_PECAS: Oligogalacturonide lyase (ogl) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01730, oligogalacturonide lyase [EC: 4.2.2.6] (inferred from 98% identity to eca:ECA2426)

MetaCyc: 88% identical to oligogalacturonate lyase (Dickeya dadantii 3937)
Oligogalacturonide lyase. [EC: 4.2.2.6]; 4.2.2.- [EC: 4.2.2.6]

Predicted SEED Role

"Oligogalacturonate lyase (EC 4.2.2.6)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>HER17_RS11540 PD40 domain-containing protein (Pectobacterium carotovorum WPP14)
MAKGNKIPLTFHTYQDSATGTEVVRLTPPDVICHRNYFYQKCFFNDGSKLLFGAAFDGPW
NYYLLDLKEQSATQLTEGKGDNTFGGFLSPNDDALYYVKNTRNLMRVDLATLEEKTIYQV
PDDWVGYGTWVANSDCTKMVGIEIKKEDWKPLTDWKKFQEFYFTNPCCRLIRVDLITGEA
ETILQENQWLGHPIYRPGDDNTVAFCHEGPHDLVDARMWFINEDGTNMRKVKEHAEGESC
THEFWVPDGSAMIYVSYLKDDTNRYIRSIDPVTLEDRQLRVMPPCSHLMSNYDGTLLVGD
GSDAPVDVQDDGGYKIENDPFLYVFNLKTGKEHRIAQHNTSWDVLEGDRQVTHPHPSFTP
DNKQVLFTSDVDGKPALYLAKVPDSVWH