Protein Info for HER17_RS11475 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 138 to 169 (32 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 19 to 287 (269 residues), 190.6 bits, see alignment E=4.6e-60 PF00005: ABC_tran" amino acids 349 to 498 (150 residues), 119.1 bits, see alignment E=2.4e-38

Best Hits

Swiss-Prot: 60% identical to YWJA_BACSU: Uncharacterized ABC transporter ATP-binding protein YwjA (ywjA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 98% identity to pct:PC1_1896)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>HER17_RS11475 ABC transporter ATP-binding protein/permease (Pectobacterium carotovorum WPP14)
MLRRFFSYYSPYKGLFVLDFGCAIIAGLLELGFPMAIKAFIDKLLPAQDWSLILLASVAL
LAVYLLNTALMAIVNYWGHALGVGIETDMRRQAFEHLQNLPFRYYDNMKTGHIITHVTKD
LEEVGEIAHHGPEDLFLAIMTFIGAFILMATVHLNLALLTIIIVPFMTYLVSRYGARMTE
TWRQLFGQVGNFNARIEESVGGIRVVKAFANEDHEKKLFSHDNENYRRTKLQAYRIMTAS
MTLSYLSTRLIQLIVMLAGIWYVIQGELSYGGFIGFLLLIEVFFRPVAKITSVLESYPKG
IAGFKRFTQLIDTVPEIADAPDAHDAGPLKGDIRFNQVSFGYSADRPILRNIDLSIRAGE
TVAFVGPSGAGKTTLCSLLPRFYDLTSGAITIDGMDIRQMTQASLRSQIGIVQQDVFLFG
GTIRENIAYGKLDASDDEIMEAARRARLDELIENLPDGLDTVVGERGVKLSGGQKQRLSI
ARIFLKNPPILILDEATSALDTATEQAIQQSLSELSAGRTTLIIAHRLATIQNAGRIVVV
DNGSIIEQGSHQVLLDQSGIYARLHQAQFGQV