Protein Info for HER17_RS10705 in Pectobacterium carotovorum WPP14

Annotation: bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00106: adh_short" amino acids 2 to 188 (187 residues), 183.6 bits, see alignment E=7.4e-58 PF01370: Epimerase" amino acids 3 to 163 (161 residues), 26.6 bits, see alignment E=9.4e-10 PF08659: KR" amino acids 4 to 161 (158 residues), 44.2 bits, see alignment E=5.2e-15 PF13561: adh_short_C2" amino acids 7 to 220 (214 residues), 123.8 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 78% identical to YDFG_ECOL6: NADP-dependent 3-hydroxy acid dehydrogenase YdfG (ydfG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to pct:PC1_2050)

MetaCyc: 78% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"Probable oxidoreductase ydfG (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>HER17_RS10705 bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG (Pectobacterium carotovorum WPP14)
MIIFVTGATAGFGESITRKFISAGHKVIATGRRQERLDALKAELGDALYPLKLDVRDRQA
IEQAVATLPAEWRTIDVLVNNAGLALGLEPAHKASVDDWENMIDTNNKGLVFMTRALLPA
MVERNIGHVINIGSTAGNWPYAGGNVYGASKAFVQQFSLGLRADLSGTRIRVTNIEPGLV
GGTEFSAVRFKGNDDKVSKTYDNTTPLTAEDVSEAVFWVATLPAHVNINTLEMMPVSQSF
AGLSVHREG