Protein Info for HER17_RS10410 in Pectobacterium carotovorum WPP14

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details PF03600: CitMHS" amino acids 15 to 306 (292 residues), 129.5 bits, see alignment E=8.3e-42

Best Hits

KEGG orthology group: None (inferred from 60% identity to ebi:EbC_14370)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>HER17_RS10410 membrane protein (Pectobacterium carotovorum WPP14)
MRELLTPFMRDKFLHALVVLGIVLSFFAVFKTDELTASVDWKTILTLTTLLMLTKGIELS
GYFDKMGLKLVNKFRKQKTLALFIVTLAALLSTFLTNDVALFITVPLTLSLSKASDFPVG
RLIIFEALAVNAGSLLTPIGNPQNILLWSKSGLSFMEFVMGMLPLSALLFIALLILTACS
FSNNEVATPNKSLKGDYRHGLLLCTLVLYVLFIVALELDKILPVLILVPLFYLLFARRVL
LQLDWGLLAVFVLMFIDVFLLTKLPALSNLIALIPHWSDGAHFLLAIGLSQVISNVPATI
FLLHAVPSSVLLTWAVNIGGFGLLQGSMANIIALRMANDRRIWWQFHLFSIPALFFAMIA
GWLMLY