Protein Info for HER17_RS10335 in Pectobacterium carotovorum WPP14

Annotation: ClbS/DfsB family four-helix bundle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF08020: DUF1706" amino acids 1 to 166 (166 residues), 180.7 bits, see alignment E=1.1e-57

Best Hits

KEGG orthology group: None (inferred from 92% identity to pct:PC1_2145)

MetaCyc: 61% identical to colibactin cyclopropane hydrolase (Escherichia coli IHE3034)
RXN-21171

Predicted SEED Role

"FIG00904640: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>HER17_RS10335 ClbS/DfsB family four-helix bundle protein (Pectobacterium carotovorum WPP14)
MAVPESKEALIKAINSQFALLMKRIEAVPAERAFLPEMAGHAQGTQMSAANLVAYLLGWG
NLVLKWHEDEEQGKPIDFPETGYQWNQLGLLAQKFYQDFAHITDWSELVARLVANKRALI
ALVERYTDAQLYGECWYGKWTRGRMIQFNTASPYKNAAGRLRAWEKNK