Protein Info for HER17_RS10330 in Pectobacterium carotovorum WPP14

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03558: luciferase family oxidoreductase, group 1
  • amino acids 5 to 325 (321 residues), 345.4 bits, E=1.6e-107
• PF00296: Bac_luciferase
  • amino acids 14 to 298 (285 residues), 115.9 bits, E=1.3e-37

Best Hits

Swiss-Prot: 45% identical to YTMO_BACSU: Uncharacterized protein YtmO (ytmO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 95% identity to pwa:Pecwa_2486)

MetaCyc: 45% identical to N-acetyl-S-alkylcysteine monooxygenase (Bacillus subtilis subtilis 168)
1.14.14.-; 1.14.14.-

Predicted SEED Role

"Bacterial luciferase family protein YtmO, in cluster with L-cystine ABC transporter"

MetaCyc Pathways

• S-benzyl-L-cysteine degradation (3/5 steps found)

Protein Sequence (326 amino acids)

>HER17_RS10330 LLM class flavin-dependent oxidoreductase (Pectobacterium carotovorum WPP14)
MGYKLSLLDQSPIAEGMSAAQALAQTVSLAKVAEALGYHRFWVSEHHNSDELAGSSPEVL
ITWLLAHTTTLRIGSGGVMLQHYSPYKVAENFHVISALAGGRVDLGIGKAPGGLPLATRA
LQQEIGETQRVAFTEKLHQLNRFLDSHDETAERLNATPLPEQTPQRFLLGASQESARLAA
SLGWNFVFAGFINASETLLTESLLSYRELKPASAQTLLSLSVIAAERHEDAEALASTQHN
YKVYIENKPPLTVGSQEQADNFVRQAGATDFRIVQEPRHVLYGTPEHIHEHLDSYHQRFG
VDEFIIHTPVTSPREREASIRLLAQR