Protein Info for HER17_RS09565 in Pectobacterium carotovorum WPP14

Annotation: YcjF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 70 to 87 (18 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details TIGR01620: TIGR01620 family protein" amino acids 56 to 340 (285 residues), 435.6 bits, see alignment E=4.1e-135 PF05128: DUF697" amino acids 182 to 340 (159 residues), 187.5 bits, see alignment E=7.7e-60

Best Hits

Swiss-Prot: 99% identical to Y2326_PECCP: UPF0283 membrane protein PC1_2326 (PC1_2326) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K08990, putative membrane protein (inferred from 98% identity to eca:ECA1987)

Predicted SEED Role

"Membrane protein YcjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>HER17_RS09565 YcjF family protein (Pectobacterium carotovorum WPP14)
MNEPLKPRVTFDDVSPQEPQPQLRAGLAFDEQSGTPFSPISREEEVPEEGAAEEAISAAL
RPKRSLWRRMVMAGIGLFGVSALAQGVQSLHNAWVQQDWIALGGITAGSLIVAAGVGSLA
VEWRRLYRLRERAEERDVARDLLHSHGVGRGREFCEKLARQAGLDSGHPAIQRWQASLHE
THNDREVLELYARLVQPVLDTQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN
RIAALYGIELGYFSRIRLFRLVLVNIAFAGASELVREIGMDWMSQDLAARLSTRAAQGIG
AGLLTARLGIKAMELCRPLPWLDDKPRLGDFRRELIGQVKETLQKGR