Protein Info for HER17_RS07755 in Pectobacterium carotovorum WPP14

Annotation: phage tail tape measure protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 960 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 544 to 566 (23 residues), see Phobius details amino acids 572 to 591 (20 residues), see Phobius details amino acids 616 to 640 (25 residues), see Phobius details amino acids 647 to 670 (24 residues), see Phobius details amino acids 672 to 695 (24 residues), see Phobius details amino acids 702 to 723 (22 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 210 to 554 (345 residues), 37.3 bits, see alignment E=8.1e-14 PF10145: PhageMin_Tail" amino acids 248 to 447 (200 residues), 64.9 bits, see alignment E=4.7e-22

Best Hits

KEGG orthology group: None (inferred from 93% identity to pct:PC1_3196)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (960 amino acids)

>HER17_RS07755 phage tail tape measure protein (Pectobacterium carotovorum WPP14)
MSNTLQLSVLLKAVDRATRPFKAVQTESKKLSGDIRDSQTQLKDLNAQAGRIDGFRKTKN
QLGETGAALQQAQAKAAELSAELRNSENPTKRQAQALERAKRQAATLKTEYAALRQSVQR
QRTELEQAGISTRNLSGAERQLRTNITQTTAQLDQQRAALSRVSQQQEKLNAVRKRYEKG
AEITAGVRNTSAAAFGLGSAALYAESRLIAPSVQADGHGARIAAQTGGNTADGDQYTRVI
KEVNASGVSNDLTQIADAVAAVRSTLGAMGDVGETELARISRKALDIQTALGSDATESIQ
IAAIMMKNGLAKNSDEAFDLMVSGMQRVSAQMRGELPEILHEYSTHFRNMGFSGSEAMTL
LVDMAQQGKFALDKTGDAVKEFSIRGSDMSKASIEAYDAAGLNAAKMSTAIASGGDKARV
AMQKTANGLLKIKDPAERANAAIALFGTPIEDLSIDQIPKFLSALAGAENTLGDVSGAAD
RMGDTLRDNLEGDIGRLQGAMSSLRFNLFNDDDGALRKLTQAATEWLTRVNEWVKANPEL
TRQIVMVGGAATALITVLGGIGLVAWPVMSGINALIGGAGLLSAGLRFAGTRGITPLSGG
LNRLGGMIGWLAKSPLMLLRAGTSALTSVFGAVSNPLAVIRGAMSGFGRVLMWLFTSPLA
LLRTGITLIGSALGVLLSPVGLAVAAMVGGALLIWKYWEPIQAFIGGVVEGFVAASAPII
AAFEPLQPVFTWMGDKIRALFGWFGDLLNPVKSTAAELDGAASMGKRFGEALANGLNIIM
NPLESLKKGVSWLLEKLGLVDDKSKKLPTAENIIPPKEAAALKVGVSRAPTPQGNDAQSI
ADRYSGVRDNGGGIKLGEFAVVGEHGPEIVEGPVNVTSRKKTAAMASAAMNMSAYRPIAP
TVQASAASSPISIHAPISIVAQPSQSAQDIAKEVTRQLEQRERAARSRAFSQYSYQGGEL