Protein Info for HER17_RS07085 in Pectobacterium carotovorum WPP14

Annotation: acetate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00016: acetate kinase
  • amino acids 1 to 399 (399 residues), 594.9 bits, E=3.4e-183
• PF00871: Acetate_kinase
  • amino acids 5 to 393 (389 residues), 597.4 bits, E=5.3e-184

Best Hits

Swiss-Prot: 98% identical to ACKA_PECCP: Acetate kinase (ackA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 99% identity to pwa:Pecwa_1484)

MetaCyc: 86% identical to acetate kinase (Escherichia coli K-12 substr. MG1655)
Acetate kinase. [EC: 2.7.2.1, 2.7.2.14, 2.7.2.15, 2.7.2.7]; 2.7.2.15,2.7.2.1 [EC: 2.7.2.1, 2.7.2.14, 2.7.2.15, 2.7.2.7]

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• L-threonine degradation I (6/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of L-threonine metabolism (14/18 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• acetyl-CoA fermentation to butanoate (3/7 steps found)
• methanogenesis from acetate (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (11/43 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1 or 2.7.2.14 or 2.7.2.15 or 2.7.2.7

Protein Sequence (400 amino acids)

>HER17_RS07085 acetate kinase (Pectobacterium carotovorum WPP14)
MSSKLVLVLNCGSSSLKFAIIDAINGEEYLSGLAECFNLPEARIKWKMDGGKQDAELGAG
AAHSEALNFIVNTILSQKPELSAQLVAIGHRIVHGGEKFTQSAIITDDVLQGIKDSVPFA
PLHNPAHLIGIDEALKSFPHLADKNVAVFDTAFHQTMPEESYLYALPYKLYKENHIRRYG
FHGTSHYFVSREAAKVLNKPVEELNVITCHLGNGGSVTAIRNGECVDTSMGLTPLEGLVM
GTRCGDIDPAVIFHLHDALGMDIDRINTLMTKESGLLGLTEVTSDCRYVEDNYETKADAK
RAMDVYCHRLAKYIGSYAALMEGRLDAVIFTGGIGENAAMVRELSLKKLGLLGFDVDHER
NLAARFGKGGNIAKDGTRAALVIPTNEELVIAEDAYRLTA