Protein Info for HER17_RS06565 in Pectobacterium carotovorum WPP14

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01547: SBP_bac_1" amino acids 41 to 285 (245 residues), 81.1 bits, see alignment E=3.1e-26 PF13531: SBP_bac_11" amino acids 42 to 288 (247 residues), 65.6 bits, see alignment E=1.2e-21 PF13416: SBP_bac_8" amino acids 47 to 285 (239 residues), 87.3 bits, see alignment E=3.2e-28 PF13343: SBP_bac_6" amino acids 81 to 321 (241 residues), 97.1 bits, see alignment E=2.3e-31

Best Hits

Swiss-Prot: 84% identical to FBPA_SERMA: Fe(3+)-binding periplasmic protein (fbpA) from Serratia marcescens

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 98% identity to pct:PC1_2919)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>HER17_RS06565 iron ABC transporter substrate-binding protein (Pectobacterium carotovorum WPP14)
MKLGFGLLSSAVLFASGLALSASANAAENDEGIVIYNAQHENLVKSWVDGFTKETGIKVT
LRNGSDTELGNQLVQEGKSSPADVFLTENSPSMVLVDNADLFAPLDKDTLAQVPSDYRPS
HGRWIGIAARSTVFVYNPTKFTDAQLPKSLADLAKPEWKGRWAASPSGADFQAIVSAYLE
LKGEKATQEWLKGMKENFTAYKGNSTVMKAVNAGQIDSGVIYHYYRFVDQAKTGENSNNT
KLYYFKHKDPGAFVSISGGGVLASSKHAKEAQAFIKWITGKSGQEVLRTNNAFEYAVGVN
AASNDKLVPLKDLDAPKVDAAKLNSKKVVDLMTQAGLL