Protein Info for HER17_RS06010 in Pectobacterium carotovorum WPP14

Annotation: Fe-S cluster assembly transcriptional regulator IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 225.3 bits, see alignment E=2e-71 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 159.9 bits, see alignment E=2.9e-51 PF02082: Rrf2" amino acids 3 to 132 (130 residues), 138.3 bits, see alignment E=9.1e-45

Best Hits

Swiss-Prot: 99% identical to ISCR_PECCP: HTH-type transcriptional regulator IscR (iscR) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 98% identity to pwa:Pecwa_1243)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>HER17_RS06010 Fe-S cluster assembly transcriptional regulator IscR (Pectobacterium carotovorum WPP14)
MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRG
PGGGYLLGKNANEIAVGMVISAVDESVDATRCQGREGCQGGDRCLTHTLWRDLSDRITDF
LNNITLDELVNNKEVLDVADRQDADTRRTANGRIQETINVNLRA