Protein Info for HER17_RS05565 in Pectobacterium carotovorum WPP14
Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to HPPK_ECOLI: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Escherichia coli (strain K12)
KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 94% identity to pct:PC1_3117)MetaCyc: 72% identical to 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (Escherichia coli K-12 substr. MG1655)
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase. [EC: 2.7.6.3]
Predicted SEED Role
"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)
MetaCyc Pathways
- superpathway of chorismate metabolism (53/59 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
- tetrahydromethanopterin biosynthesis (3/14 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.6.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (180 amino acids)
>HER17_RS05565 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase (Pectobacterium carotovorum WPP14) MTRVYLALGSNLAQPLQQVRAALSALDAIPHTRVVCCSSFYRSRPLGPQDQPDYLNAVVE LETALAAESLLDHTQAIELEQGRERKEHRWGPRTLDLDILLFGDVVIQTERLTVPHYDMK NREFMLYPLAEIAPELTFPDGETLAQRLTHVDRNGLTLWDNRKWDNQRWDDEKLTGTVDH