Protein Info for HER17_RS04670 in Pectobacterium carotovorum WPP14

Annotation: DNA polymerase IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF00817: IMS" amino acids 7 to 154 (148 residues), 172.8 bits, see alignment E=6.8e-55 PF11798: IMS_HHH" amino acids 167 to 196 (30 residues), 26.2 bits, see alignment (E = 9.7e-10) PF11799: IMS_C" amino acids 240 to 347 (108 residues), 53.7 bits, see alignment E=4e-18

Best Hits

Swiss-Prot: 97% identical to DPO4_PECAS: DNA polymerase IV (dinB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 97% identity to pct:PC1_3291)

MetaCyc: 76% identical to DNA polymerase IV (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]; 2.7.7.7 [EC: 2.7.7.7]

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>HER17_RS04670 DNA polymerase IV (Pectobacterium carotovorum WPP14)
MRKIIHVDMDCFYAAIEMRDNPRLRDIPLAIGGSADRRGVISTANYPARRYGVRSAMATA
TALRLCPHLTLLPGRMEVYKSTSRQIREIFSRYTSLIEPLSLDEAYLDVTDSPHCNGSAT
RIAEEIRRTIADELNLTASAGIAPIKFLAKIASELNKPNGQYVITPEQVDDFLLTLPLEK
IPGVGKVTAKRLEERGLHTCADVRVYALADLLKEFGKFGRVLWERCQGIDERQISPDRLR
KSVGVEKTLAQDIHDWEQCENLIEQLYEELEVRLKRVKPDLHIARQGVKLKFDDFQQTTQ
EHVWPVLNKQDLLKIAQQTWQERRKSRGVRLVGLHVTLLDPQIERQLVFDWG